PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo6G0064700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 312aa    MW: 35352.4 Da    PI: 7.6679
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo6G0064700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.28.9e-141460148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     r +W+ eEde l ++v qlG+ +W+ I++ ++  R +  c++rw+k+l
   Spipo6G0064700 14 RRPWSSEEDEDLTRLVGQLGTSSWNFISAGIP-DRNPRACRHRWLKHL 60
                     679*****************************.*************96 PP

2Myb_DNA-binding45.32e-1466110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T++Ede ++ a++++G++ W++Iar ++  Rt   ++ rw++ 
   Spipo6G0064700  66 RRPFTADEDETIIAAHAKYGNR-WAAIARLLP-ARTNVAVVYRWYTT 110
                      679*******************.*********.************87 PP

3Myb_DNA-binding46.21.1e-14161206147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W+ eEde l ++v q+G+++W+ +++ ++ gR+  +c+ rw+k 
   Spipo6G0064700 161 RRPWSSEEDEELTRLVGQHGTNSWNVVSAGIP-GRSNSSCRVRWLKC 206
                      679*****************************.***********996 PP

4Myb_DNA-binding49.69.1e-16215257347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T++Ed++++ a++++G++ W++Iar ++ gRt+  +k+rw + 
   Spipo6G0064700 215 PFTADEDKIIIAAHAKYGNK-WTAIARLLP-GRTDAKVKNRWSTT 257
                      89******************.*********.***********875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.74E-2612107IPR009057Homeodomain-like
SMARTSM007179.0E-111362IPR001005SANT/Myb domain
PROSITE profilePS5009010.8011460IPR017877Myb-like domain
CDDcd001672.87E-91660No hitNo description
Gene3DG3DSA:1.10.10.601.8E-191667IPR009057Homeodomain-like
PfamPF139215.5E-131775No hitNo description
PROSITE profilePS5129418.64561115IPR017930Myb domain
SMARTSM007175.7E-1365113IPR001005SANT/Myb domain
CDDcd001671.52E-968111No hitNo description
Gene3DG3DSA:1.10.10.602.8E-1968114IPR009057Homeodomain-like
PROSITE profilePS5129413.531156207IPR017930Myb domain
SuperFamilySSF466898.11E-29158254IPR009057Homeodomain-like
SMARTSM007171.0E-11160209IPR001005SANT/Myb domain
PfamPF002494.6E-13161206IPR001005SANT/Myb domain
CDDcd001676.18E-10163205No hitNo description
Gene3DG3DSA:1.10.10.605.1E-20163214IPR009057Homeodomain-like
PROSITE profilePS5129422.445208262IPR017930Myb domain
SMARTSM007174.7E-13212260IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-21215259IPR009057Homeodomain-like
PfamPF002491.7E-13215256IPR001005SANT/Myb domain
CDDcd001673.05E-10215258No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDDAEHEGQH PAIRRPWSSE EDEDLTRLVG QLGTSSWNFI SAGIPDRNPR ACRHRWLKHL  60
QPDVERRPFT ADEDETIIAA HAKYGNRWAA IARLLPARTN VAVVYRWYTT LAREWWTELS  120
DAAAGEPTTS LRIDLQGYEE VPVAGGGGDQ RENERRDRII RRPWSSEEDE ELTRLVGQHG  180
TNSWNVVSAG IPGRSNSSCR VRWLKCLSPD VEHRPFTADE DKIIIAAHAK YGNKWTAIAR  240
LLPGRTDAKV KNRWSTTLAW NRTEFDATGS KPTTSLPIRL PRDEEPPVAG SRGGDKRGNE  300
EMEAYLMSRR R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-27132589158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-27132589158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461001.12e-38PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW17e-37MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2V6S92e-38A0A0D2V6S9_G
STRINGBRADI4G08220.15e-37(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-37myb domain protein r1